Overview

  • Product name
    Recombinant Human LIN9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHRGGQPLKKRRGSFKMAELDQLPDESSSAKALVSLKEGSLSNTWNEKYS SLQKTPVWKGRNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVA MVPQKFTATMSTPDKKASQKIGFRLRNLLKLPKAHKWCIYEWFYSNIDKP LFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMGKPRRCSSAFFEEE RSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGTKVTARLRGVH DGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAA FGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTET LGGFPVEFLIQVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEF QRRYATIVLELEQLNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRR CEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLAEGGDLN SFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSGLSQMGNLHAF AANNTNRD
    • Amino acids
      1 to 558
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BARA
    • Beta subunit-associated regulator of apoptosis
    • Beta-subunit associated regulator of apoptosis
    • hLin-9
    • huLin-9
    • lin-9
    • lin9
    • LIN9_HUMAN
    • pRB-associated protein
    • Protein lin-9 homolog
    • TGS
    • TUDOR gene similar protein
    • Type I interferon receptor beta chain-associated protein
    see all
  • Function
    Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition.
  • Tissue specificity
    Expressed in thymus and testis.
  • Sequence similarities
    Belongs to the lin-9 family.
  • Cellular localization
    Nucleus > nucleoplasm. Found in perinucleolar structures. Associated with chromatin.
  • Information by UniProt

Images

  • ab153641 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up