Recombinant Human Lingo1 protein (ab153558)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRYECSAQDRAVL CHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENI VSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIV ILLDYMFQDLYNLRSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSI PTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMT PNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNRISTIEGSM LHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFH SVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKE FKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAI LWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGND SMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT LIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGI SSADAPRKFNMKMI
    • Amino acids
      1 to 614
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ14594
    • LERN 1
    • LERN1
    • Leucine rich repeat and Ig domain containing 1
    • Leucine rich repeat neuronal 6A
    • Leucine rich repeat neuronal protein 1
    • Leucine rich repeat neuronal protein 6A
    • Leucine-rich repeat and immunoglobilin domain-containing protein 1
    • Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
    • Leucine-rich repeat neuronal protein 1
    • Leucine-rich repeat neuronal protein 6A
    • LIGO1_HUMAN
    • Lingo 1
    • LINGO1
    • LRR and Ig domain containing Nogo Receptor interating protein
    • Lrrn 6a
    • Lrrn6a
    • Lrrn6a protein
    • MGC17422
    • Nogo Receptor interacting protein
    • PRO227
    • UNQ201
    see all
  • Function
    Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors. Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination. Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development.
  • Tissue specificity
    Expressed exclusively in the central nervous system. Highest level in the in amygdala, hippocampus, thalamus and cerebral cortex. In the rest of the brain a basal expression seems to be always present. Up-regulated in substantia nigra neurons from Parkinson disease patients.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications
    N-glycosylated. Contains predominantly high-mannose glycans.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153558 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up