Overview

  • Product name
    Recombinant Human LIPA3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQ NAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDL
    • Amino acids
      1043 to 1139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LIPA3_HUMAN
    • liprin
    • Liprin-alpha-3
    • LPNA3
    • Ppfia3
    • Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3
    • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
    • protein tyrosine phosphatase, receptor type, f polypeptide, alpha 3
    • PTPRF-interacting protein alpha-3
    see all
  • Function
    May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates.
  • Tissue specificity
    Expressed only in brain.
  • Sequence similarities
    Belongs to the liprin family. Liprin-alpha subfamily.
    Contains 3 SAM (sterile alpha motif) domains.
  • Domain
    The N-terminal coiled coil regions mediate homodimerization preferentially and heterodimerization type alpha/alpha. The C-terminal, non-coiled coil regions mediate heterodimerization type alpha/beta and interaction with PTPRD, PTPRF and PTPRS.
  • Cellular localization
    Cytoplasm. Cell surface. Colocalizes with PTPRF at the cell surface.
  • Information by UniProt

Images

  • ab160085 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up