Recombinant Human Lipoprotein lipase (ab115500)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP06858
    • SpeciesHuman
    • SequenceMKHHHHHHASADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATC HFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA QEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGI AGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSP GRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCS HERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEI SKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLY GTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW SDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHD KSLNKKSG
    • Molecular weight52 kDa including tags
    • Amino acids28 to 475
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115500 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 4.00
    Constituents: 0.4% Sodium acetate, 0.3% Acetic acid

  • ReconstitutionTo reconstitute, add 0.1M Acetate buffer pH4. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week. In higher concentrations the solubility of this antigen is limited. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • EC 3.1.1
    • EC 3.1.1.34
    • HDLCQ11
    • LIPD
    • LIPL_HUMAN
    • Lipoprotein lipase
    • LPL
    • LPL protein
    • MGC137861
    see all
  • FunctionThe primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium.
  • Involvement in diseaseDefects in LPL are the cause of lipoprotein lipase deficiency (LPL deficiency) [MIM:238600]; also known as familial chylomicronemia or hyperlipoproteinemia type I. LPL deficiency chylomicronemia is a recessive disorder usually manifesting in childhood. On a normal diet, patients often present with abdominal pain, hepatosplenomegaly, lipemia retinalis, eruptive xanthomata, and massive hypertriglyceridemia, sometimes complicated with acute pancreatitis.
  • Sequence similaritiesBelongs to the AB hydrolase superfamily. Lipase family.
    Contains 1 PLAT domain.
  • Post-translational
    modifications
    Tyrosine nitration after lipopolysaccharide (LPS) challenge down-regulates the lipase activity.
  • Cellular localizationCell membrane. Secreted. Locates to the plasma membrane of microvilli of hepatocytes with triacyl-glycerol-rich lipoproteins (TRL). Some of the bound LPL is then internalized and located inside non-coated endocytic vesicles.
  • Information by UniProt

Recombinant Human Lipoprotein lipase images

  • 14% SDS-PAGE showing ab115500
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References for Recombinant Human Lipoprotein lipase (ab115500)

ab115500 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115500.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"