Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTG PDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCN KMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPN CRALLGTYKRL
    • Amino acids
      1 to 161
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lipopolysaccharide induced TNF alpha factor
    • CMT1C
    • FLJ38636
    • Lipopolysaccharide induced TNF alpha factor
    • Lipopolysaccharide induced TNF factor
    • Lipopolysaccharide induced tumor necrosis factor alpha factor
    • Lipopolysaccharide-induced tumor necrosis factor-alpha factor
    • LITAF
    • LITAF_HUMAN
    • LPS induced TNF alpha factor
    • LPS-induced TNF-alpha factor
    • MGC116698
    • MGC116700
    • MGC116701
    • MGC125274
    • MGC125275
    • MGC125276
    • p53 induced gene 7 protein
    • p53-induced gene 7 protein
    • PIG 7
    • PIG7
    • SIMPLE
    • Small integral membrane protein of lysosome/late endosome
    • TP53I7
    • Tumor protein p53 inducible protein 7
    see all
  • Function
    Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.
  • Tissue specificity
    Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
  • Involvement in disease
    Defects in LITAF are the cause of Charcot-Marie-Tooth disease type 1C (CMT1C) [MIM:601098]. CMT1C is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet.
    Note=Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis. EMPD is a cancerous disease representing about 8% of all malignant skin cancers; it usually appears in the anogenital area and can be fatal by metastasizing to internal organs when left untreated for a long time. The clinical features are usually those of eczematous eruptions with weeping and crust formation.
  • Domain
    The WW-binding motif mediates interaction with WWOX and, probably NEDD4.
  • Cellular localization
    Lysosome membrane. Associated with membranes of lysosomes.
  • Information by UniProt

Images

  • ab152995 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up