Recombinant human Liver Arginase protein (ab168047)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDY GDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK ELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM TEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVG GLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAIT LACFGLAREGNHKPIDYLNPPK
    • Molecular weight
      35 kDa
    • Amino acids
      1 to 322

Specifications

Our Abpromise guarantee covers the use of ab168047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: ~2.0U/µg protein. One unit is defined as the amount of enzyme that converts 1µmol of L-arginine to L-ornithine and urea per min. at 37°C, pH 9.5
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.008% Beta mercaptoethanol, 0.16% Tris HCl, 50% Glycerol, 0.013% Manganese chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • A I
    • Al
    • ARG 1
    • arg1
    • ARGI1_HUMAN
    • Arginase 1
    • Arginase liver
    • Arginase type I
    • Arginase, liver
    • Arginase-1
    • Arginase1
    • Liver type arginase
    • Liver-type arginase
    • Type I arginase
    see all
  • Pathway
    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Involvement in disease
    Defects in ARG1 are the cause of argininemia (ARGIN) [MIM:207800]; also known as hyperargininemia. Argininemia is a rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia, progressive spastic quadriplegia.
  • Sequence similarities
    Belongs to the arginase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab168047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up