Recombinant Human Liver Arginase protein (ab185382)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDY GDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD HSLAIGSISGHARVHPDLGVIWVDAHTDIN TPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR DVDPGEHYILKTLGI KYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATG TPVVGGLTYREGLYI TEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREG NHKPIDYLNPPKLEH HHHHH
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 322
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 20% Glycerol, 0.32% Tris HCl, 0.88% Sodium chloride, 0.02% DTT

    0.2 µM filtered

General Info

  • Alternative names
    • A I
    • Al
    • ARG 1
    • arg1
    • ARGI1_HUMAN
    • Arginase 1
    • Arginase liver
    • Arginase type I
    • Arginase, liver
    • Arginase-1
    • Arginase1
    • Liver type arginase
    • Liver-type arginase
    • Type I arginase
    see all
  • Pathway
    Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
  • Involvement in disease
    Defects in ARG1 are the cause of argininemia (ARGIN) [MIM:207800]; also known as hyperargininemia. Argininemia is a rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia, progressive spastic quadriplegia.
  • Sequence similarities
    Belongs to the arginase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab185382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up