Recombinant Human Liver Carboxylesterase 1 protein (ab114347)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIF LGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAAS TYDGLALAAHENVVVVTIQYRLGTWGFFSTGDEHSRGNWGHLDQVAALRW VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVA LTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI NKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATE KYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAGAPTYMYEFQY RPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA NFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLF AKKAVEKPPQTEHIEL
    • Molecular weight
      88 kDa including tags
    • Amino acids
      1 to 567
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACAT
    • Acyl coenzyme A cholesterol acyltransferase
    • Acyl-coenzyme A:cholesterol acyltransferase
    • Brain carboxylesterase hBr1
    • Carboxyesterase ES-3
    • Carboxylesterase
    • Carboxylesterase 1
    • Carboxylesterase 1 (monocyte/macrophage serine esterase 1)
    • Carboxylesterase 1 deficiency, included
    • Carboxylesterase 2, formerly
    • CE 1
    • CEH
    • Ces-1
    • CES1
    • CES2
    • CESDD1
    • Cholesterol ester hydrolase, neutral, macrophage-derived
    • Cholesteryl ester hydrolase
    • Cocaine carboxylesterase
    • EC 3.1.1.1
    • Egasyn
    • ES-HTEL
    • ES-x
    • Es22
    • EST1_HUMAN
    • Esterase
    • Esterase 22
    • hCE 1
    • HMSE
    • HMSE1
    • Liver carboxylesterase 1
    • Liver carboxylesterase 3
    • Methylumbelliferyl acetate deacetylase 1
    • MGC117365
    • MGC156521
    • Monocyte carboxylesterase deficiency, included
    • Monocyte esterase deficiency, included
    • Monocyte/macrophage serine esterase
    • PCE-1
    • pI 5.5 esterase
    • Proline-beta-naphthylamidase
    • REH
    • Retinyl ester hydrolase
    • Serine esterase 1
    • Ses-1
    • SES1
    • TGH
    • Triacylglycerol hydrolase
    see all
  • Function
    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl-CoA ester. Hydrolyzes the methyl ester group of cocaine to form benzoylecgonine. Catalyzes the transesterification of cocaine to form cocaethylene. Displays fatty acid ethyl ester synthase activity, catalyzing the ethyl esterification of oleic acid to ethyloleate.
  • Tissue specificity
    Expressed predominantly in liver with lower levels in heart and lung.
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Post-translational
    modifications
    Contains sialic acid.
    Cleavage of the signal sequence can occur at 2 positions, either between Trp-17 and Gly-18 or between Gly-18 and His-19.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab114347 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up