Overview

  • Product name
    Recombinant Human LLGL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQA SYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      911 to 1010

Specifications

Our Abpromise guarantee covers the use of ab114953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DLG4
    • DLG4, formerly
    • HUGL
    • Hugl 1
    • Hugl-1
    • HUGL1
    • Human homolog to the D-lgl gene protein
    • L2GL1_HUMAN
    • Lethal giant larvae homolog 1
    • Lethal giant larvae homolog 1 (Drosophila)
    • Lethal(2) giant larvae protein homolog 1
    • LLGL
    • Llgl1
    • Ly 49G2
    • Ly49G2
    • Mgl1
    • Mlgl
    see all
  • Function
    Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells.
  • Tissue specificity
    Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease.
  • Sequence similarities
    Belongs to the WD repeat L(2)GL family.
    Contains 14 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylated at least at Ser-663 by PRKCI.
  • Cellular localization
    Cytoplasm > cytoskeleton. Localized to the lateral membrane during the polarization and formation cell-cell contacts.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114953 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up