Overview

  • Product name
    Recombinant Human LLGL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQA SYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      911 to 1010

Specifications

Our Abpromise guarantee covers the use of ab114953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DLG4
    • DLG4, formerly
    • HUGL
    • Hugl 1
    • Hugl-1
    • HUGL1
    • Human homolog to the D-lgl gene protein
    • L2GL1_HUMAN
    • Lethal giant larvae homolog 1
    • Lethal giant larvae homolog 1 (Drosophila)
    • Lethal(2) giant larvae protein homolog 1
    • LLGL
    • Llgl1
    • Ly 49G2
    • Ly49G2
    • Mgl1
    • Mlgl
    see all
  • Function
    Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells.
  • Tissue specificity
    Expressed in brain, kidney, and muscle but is barely seen in heart and placenta. Down-regulated or lost in all cell lines and in most of the tumor samples analyzed. Loss was associated with advanced stage of the disease.
  • Sequence similarities
    Belongs to the WD repeat L(2)GL family.
    Contains 14 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylated at least at Ser-663 by PRKCI.
  • Cellular localization
    Cytoplasm > cytoskeleton. Localized to the lateral membrane during the polarization and formation cell-cell contacts.
  • Information by UniProt

Recombinant Human LLGL1 protein images

  • 12.5% SDS-PAGE showing ab114953 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human LLGL1 protein (ab114953)

ab114953 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up