Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6P1M3
    • SpeciesHuman
    • SequenceSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTES GNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
    • Molecular weight37 kDa including tags
    • Amino acids101 to 199

Specifications

Our Abpromise guarantee covers the use of ab114369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HGL
    • Human giant larvae homolog
    • L2GL2
    • L2GL2_HUMAN
    • Lethal 2 giant larvae protein homolog 2
    • Lethal giant larvae homolog 2
    • Lethal(2) giant larvae protein homolog 2
    • LGL2
    • LLGL2
    see all
  • FunctionPart of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.
  • Sequence similaritiesBelongs to the WD repeat L(2)GL family.
    Contains 14 WD repeats.
  • Post-translational
    modifications
    Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.
  • Cellular localizationCytoplasm. Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.
  • Information by UniProt

Recombinant Human LLGL2 protein images

  • 12.5% SDS-PAGE showing ab114369 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human LLGL2 protein (ab114369)

ab114369 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"