Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTES GNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      101 to 199

Specifications

Our Abpromise guarantee covers the use of ab114369 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HGL
    • Human giant larvae homolog
    • L2GL2
    • L2GL2_HUMAN
    • Lethal 2 giant larvae protein homolog 2
    • Lethal giant larvae homolog 2
    • Lethal(2) giant larvae protein homolog 2
    • LGL2
    • LLGL2
    see all
  • Function
    Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.
  • Sequence similarities
    Belongs to the WD repeat L(2)GL family.
    Contains 14 WD repeats.
  • Post-translational
    modifications
    Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.
  • Cellular localization
    Cytoplasm. Localized in the perinuclear structure and faintly at the cell-cell contacts sites in the interphase. Localized at the cell periphery during metaphase. Cortical localization in mitotic cells. Found in the lateral region of polarized epithelial cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114369 at approximately 36.52kDa stained with Coomassie Blue.

References

ab114369 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114369.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up