Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6NZ39
    • SpeciesHuman
    • SequenceMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAE PLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HGNC:6653
    • LIM homeobox protein 1.1
    • LIM homeobox transcription factor 1 alpha
    • LIM homeobox transcription factor 1-alpha
    • LIM/homeobox protein 1.1
    • LIM/homeobox protein LMX1A
    • LMX 1
    • LMX 1.1
    • LMX 1A
    • LMX-1.1
    • LMX1
    • LMX1.1
    • LMX1A
    • LMX1A_HUMAN
    • MGC87616
    see all
  • FunctionActs as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.
  • Tissue specificityIsoform 1 is expressed in many tissues. Not found in heart, liver, spleen and testis. Relatively highly expressed in fetal brain. Isoform LMX1A-4B is expressed in testis.
  • Sequence similaritiesContains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human LMX1A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114765 at approximately 37.07kDa.

References for Recombinant Human LMX1A protein (ab114765)

ab114765 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"