Recombinant Human LOC91614 protein (ab164869)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDV FKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTK DELLNLL
    • Amino acids
      393 to 499
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DEP domain containing 7
    • DEP domain containing protein 7
    • DEP domain-containing protein 7
    • DEPD7_HUMAN
    • depdc7
    • dJ85M6.4
    • dJ85M6.4 (novel 58.3 KDA protein)
    • Novel 58.3 KDA protein
    • Protein TR2/D15
    • TR2
    see all
  • Tissue specificity
    Expressed in liver.
  • Sequence similarities
    Belongs to the DEPDC7 family.
    Contains 1 DEP domain.
  • Information by UniProt

Images

  • ab164869 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up