Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGQRTCDASP PWALWGRGPAIGGQWRGFWEASSRGGGAFSGGEDASEGGAEEGAGGAGGS AGAGEGPVITALTPMTIPDVFPHLPLIAITRNPVFPRFIKIIEVKNKKLV ELLRRKVRLAQPYVGVFLKRDDSNESDVVESLDEIYHTGTFAQIHEMQDL GDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSKRGKKEAEDEL SARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTI RDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVL EETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQL KIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDN HSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKR ILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVG GMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQ GDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLR DRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLI KQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPV FTVERMYDVTPPGVVMGLAWTAMGGSTLFVETSLRRPQDKDAKGDKDGSL EVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATP KDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTI AAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDE QAEALAVER
    • Amino acids
      1 to 959
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hLON
    • hLON ATP dependent protease
    • LON
    • lon peptidase 1, mitochondrial
    • LON protease
    • Lon protease homolog
    • Lon protease like protein
    • Lon protease-like protein
    • LONHs
    • LONM_HUMAN
    • LONP
    • Lonp1
    • MGC1498
    • mitochondrial
    • Mitochondrial ATP dependent protease Lon
    • Mitochondrial ATP-dependent protease Lon
    • Mitochondrial lon peptidase 1
    • PIM1
    • Protease serine 15
    • PRSS15
    • Serine protease 15
    see all
  • Function
    ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial promoters and RNA in a single-stranded, site-specific, and strand-specific manner. May regulate mitochondrial DNA replication and/or gene expression using site-specific, single-stranded DNA binding to target the degradation of regulatory proteins binding to adjacent sites in mitochondrial promoters. Endogenous substrates include mitochondrial steroidogenic acute regulatory (StAR) protein.
  • Tissue specificity
    Duodenum, heart, lung and liver, but not thymus.
  • Involvement in disease
    CODAS syndrome
  • Sequence similarities
    Belongs to the peptidase S16 family.
    Contains 1 Lon domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab160451 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up