Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESD YSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      675 to 773

Specifications

Our Abpromise guarantee covers the use of ab152505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LOR 2
    • LOR2
    • LOX L2
    • LOXL 2
    • LOXL2
    • LOXL2_HUMAN
    • Lysyl oxidase homolog 2
    • Lysyl oxidase like 2
    • Lysyl oxidase like protein 2
    • Lysyl oxidase related 2
    • Lysyl oxidase related protein 2
    • Lysyl oxidase related protein WS9 14
    • Lysyl oxidase-like protein 2
    • Lysyl oxidase-related protein 2
    • Lysyl oxidase-related protein WS9-14
    • WS9 14
    see all
  • Tissue specificity
    Expressed in many tissues. Highest expression in reproductive tissues, placenta, uterus and prostate.
  • Sequence similarities
    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications
    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152505 stained with Coomassie Blue.

References

ab152505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up