Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVA ESDFSNNMLQCRCKYDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNL
    • Amino acids
      657 to 755
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4833426I20Rik
    • FLJ21889
    • LOX L4
    • LOXC
    • LOXL 4
    • LOXL4
    • LOXL4_HUMAN
    • Lysyl oxidase homolog 4
    • Lysyl oxidase like 4
    • Lysyl oxidase like protein 4
    • Lysyl oxidase related C
    • Lysyl oxidase related protein C
    • Lysyl oxidase-like protein 4
    • Lysyl oxidase-related protein C
    see all
  • Function
    May modulate the formation of a collagenous extracellular matrix.
  • Tissue specificity
    Expressed in many tissues, the highest levels among the tissues studied being in the skeletal muscle, testis and pancreas. Expressed in cartilage.
  • Sequence similarities
    Belongs to the lysyl oxidase family.
    Contains 4 SRCR domains.
  • Post-translational
    modifications
    The lysine tyrosylquinone cross-link (LTQ) is generated by condensation of the epsilon-amino group of a lysine with a topaquinone produced by oxidation of tyrosine.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab153549 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up