Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALT DDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGANILVNHLDESLQ
    • Amino acids
      33 to 132
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LCA14
    • Lecithin retinol acyltransferase
    • Lecithin retinol acyltransferase (phosphatidylcholine retinol O acyltransferase)
    • LRAT
    • LRAT_HUMAN
    • Phosphatidylcholine retinol O acyltransferase
    • Phosphatidylcholine--retinol O-acyltransferase
    see all
  • Function
    Transfers the acyl group from the sn-1 position of phosphatidylcholine to all-trans retinol, producing all-trans retinyl esters. Retinyl esters are storage forms of vitamin A. LRAT plays a critical role in vision. It provides the all-trans retinyl ester substrates for the isomerohydrolase which processes the esters into 11-cis-retinol in the retinal pigment epithelium; due to a membrane-associated alcohol dehydrogenase, 11 cis-retinol is oxidized and converted into 11-cis-retinaldehyde which is the chromophore for rhodopsin and the cone photopigments.
  • Tissue specificity
    Hepatic stellate cells and endothelial cells (at protein level). Found at high levels in testis and liver, followed by retinal pigment epithelium, small intestine, prostate, pancreas and colon. Low expression observed in brain. In fetal tissues, expressed in retinal pigment epithelium and liver, and barely in the brain.
  • Pathway
    Cofactor metabolism; retinol metabolism.
  • Involvement in disease
    Defects in LRAT are a cause of Leber congenital amaurosis type 14 (LCA14) [MIM:613341]. It is a severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus.
  • Sequence similarities
    Belongs to the H-rev107 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Rough endoplasmic reticulum. Endosome > multivesicular body. Cytoplasm > perinuclear region. Present in the rough endoplasmic reticulum and multivesicular body in hepatic stellate cells. Present in the rough endoplasmic reticulum and perinuclear region in endothelial cells.
  • Information by UniProt

Images

  • ab160392 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up