Overview

  • Product name
    Recombinant Human LRFN1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPGPFSSALLSPPPAALPFLLLLWAGASRGQPCPGRCICQNVAPTLTML CAKTGLLFVPPAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNT IGQVAAGAFADLRALRALHLDSNRLAEVRGDQLRGLGNLRHLILGNNQIR RVESAAFDAFLSTVEDLDLSYNNLEALPWEAVGQMVNLNTLTLDHNLIDH IAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGTGPKPPTPLTVSFG GNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPL ITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVR GDGTLDVTITTLRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAP PPLTEPGSSDIATPGRPGANDSAAERRLVAAELTSNSVLIRWPAQRPVPG IRMYQVQYNSSVDDSLVYRMIPSTSQTFLVNDLAAGRAYDLCVLAVYDDG ATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAIGGVIVASVLV FIVLLMIRYKVYGDGDSRRVKGSRSLPRVSHVCSQTNGAGTGAAQAPALP AQDHYEALREVESQAAPAVAVEAKAMEAETASAEPEVVLGRSLGGSATSL CLLPSEETSGEESRAAVGPRRSRSGALEPPTSAPPTLALVPGGAAARPRP QQRYSFDGDYGALFQSHSYPRRARRTKRHRSTPHLDGAGGGAAGEDGDLG LGSARACLAFTSTEWMLESTV
    • Amino acids
      1 to 771
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1484
    • Leucine rich repeat and fibronectin type III domain containing 1
    • Leucine rich repeat and fibronectin type III domain containing protein 1
    • Leucine-rich repeat and fibronectin type III domain-containing protein 1
    • LRFN 1
    • lrfn1
    • LRFN1_HUMAN
    • SALM 2
    • SALM2
    • Synaptic adhesion like molecule 2
    • Synaptic adhesion-like molecule 2
    see all
  • Function
    Promotes neurite outgrowth in hippocampal neurons. Involved in the regulation and maintenance of excitatory synapses. Induces the clustering of excitatory postsynaptic proteins, including DLG4, DLGAP1, GRIA1 and GRIN1.
  • Sequence similarities
    Belongs to the LRFN family.
    Contains 1 fibronectin type-III domain.
    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 7 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Domain
    The PDZ-binding motif is required for neurite outgrowth promotion and for DLG1-, DLG3- and DLG4-binding.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Detected in excitatory, but not inhibitory, synaptic plasma membrane.
  • Information by UniProt

Images

  • ab163608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up