Recombinant Human LRG1 protein (denatured) (ab171596)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSVTLSPKDCQVFRSDHGSSISCQPPAEI PGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFL RPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHG LKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPL QLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQL DMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYR WLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
    • Molecular weight
      36 kDa including tags
    • Amino acids
      36 to 347
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 1300008B03Rik
    • 2310031E04Rik
    • A2GL
    • A2GL_HUMAN
    • HMFT1766
    • Leucine rich alpha 2 glycoprotein
    • Leucine-rich alpha-2-glycoprotein
    • Leucine-rich alpha-2-glycoprotein 1
    • Leucine-rich alpha-2-glycoprotein precursor
    • LRG
    • LRG1
    see all
  • Tissue specificity
    Plasma.
  • Sequence similarities
    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab171596.

References

ab171596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up