Overview

  • Product name
    Recombinant Human LRP12 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EHSENVHISGVSTACGETPEQIRAPSGIITSPGWPSEYPAKINCSWFIRA NPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIESYRACGSTIPPPYIS SQDHIWIRFHSDDNISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEA WKCNNMDECGDSSDEEICAKEANPPTAAAFQPCAYNQFQCLSRFTKVYTC LPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPG SNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRVL TAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEIPC GGNWGCYTEQ QRCDGYWHCPNGRDETNCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNG SDEKNCFFCQ PGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVDHHHHHH
    • Molecular weight
      53 kDa including tags
    • Amino acids
      33 to 489
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • AI848829
    • FLJ12929
    • Low density lipoprotein receptor related protein 12
    • Low-density lipoprotein receptor-related protein 12
    • LRP 12
    • LRP-12
    • LRP12
    • LRP12_HUMAN
    • ST7
    • Suppressor of tumorigenicity 7 protein
    see all
  • Function
    Probable receptor, which may be involved in the internalization of lipophilic molecules and/or signal transduction. May act as a tumor suppressor.
  • Tissue specificity
    Widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas, but not in tissues consisting of a large number of epithelial cells, such as liver and kidney. Expressed at very low levels in a number of tumor-derived cell lines.
  • Sequence similarities
    Belongs to the LDLR family.
    Contains 2 CUB domains.
    Contains 5 LDL-receptor class A domains.
  • Cellular localization
    Membrane. Membrane, coated pit.
  • Information by UniProt

References

ab151816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up