Overview

  • Product name
    Recombinant Human LRP1B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECA VYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT
    • Amino acids
      111 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Low density lipoprotein receptor-related protein 1B
    • Low density lipoprotein receptor-related protein-deleted in tumor
    • Low-density lipoprotein receptor-related protein 1B
    • Low-density lipoprotein receptor-related protein-deleted in tumor
    • LRP-1B
    • LRP-DIT
    • LRPDIT
    see all
  • Relevance
    LRP1B is part of the low density lipoprotein (LDL) receptor gene family, which play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands. LRP1B binds and internalizes LRPAP1, PLAU, PLAT and SERPINE1 in the process of receptor-mediated endocytosis and it is preferentially inactivated in non-small cell lung cancer.
  • Cellular localization
    Membrane

Images

  • ab162688 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up