Recombinant Human LRRFIP1 protein (ab152962)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVAKDNAKIDGATQSSPAEPKSEDADRCTLPEHESPSQDISDACEAESTE RCEMSEHPSQTVRKALDSNSLENDDLSAPGREPGHFNPESREDTRGGNEK GKSKEDCTMS
    • Amino acids
      675 to 784
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLAP 1
    • FLAP1
    • FLIIAP 1
    • FLIIAP1
    • GC binding factor 2
    • GC-binding factor 2
    • GCF 2
    • GCF2
    • HUFI 1
    • HUFI1
    • Leucine rich repeat (in FLII) interacting protein 1
    • Leucine rich repeat flightless interacting protein 1
    • Leucine-rich repeat flightless-interacting protein 1
    • LRR FLII interacting protein 1
    • LRR FLII-interacting protein 1
    • LRRF1_HUMAN
    • LRRFIP 1
    • Lrrfip1
    • MGC10947
    • MGC119738
    • MGC119739
    • NEDD8 conjugating enzyme
    • TAR RNA interacting protein
    • TAR RNA-interacting protein
    • Transcription factor 9 like
    • TRIP
    see all
  • Function
    Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the LRRFIP family.
  • Developmental stage
    Widely expressed in fetal tissues.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab152962 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up