Recombinant Human LRRN4CL protein (Tagged-His Tag) (ab192281)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACL CPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGS EAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGL EGADIPAFGPCSRLAVPPNPRTVDHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      23 to 194
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain of LRRN4CL.

Specifications

Our Abpromise guarantee covers the use of ab192281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab192281 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    0.2 µM filtered solution

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml

General Info

  • Alternative names
    • LRN4L_HUMAN
    • LRRN4 C terminal like
    • LRRN4 C terminal like protein
    • LRRN4 C-terminal-like protein
    • Lrrn4cl
    • MGC61707
    see all
  • Sequence similarities
    Contains 1 fibronectin type-III domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab192281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192281.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up