Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKW SLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIV QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGE EEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVT NVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLA ASLLCLLSKC
    • Molecular weight
      60 kDa including tags
    • Amino acids
      29 to 338

Specifications

Our Abpromise guarantee covers the use of ab116727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • IgLON family member 3
    • IGLON3
    • Lam
    • LAMP
    • Limbic system associated membrane protein
    • Limbic system associated membrane protein precursor
    • Limbic system-associated membrane protein
    • LSAMP
    • LSAMP_HUMAN
    see all
  • Function
    Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.
  • Tissue specificity
    Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. IgLON family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human LSAMP protein images

  • 12.5% SDS-PAGE of ab116727 stained with Coomassie Blue.

References for Recombinant Human LSAMP protein (ab116727)

ab116727 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up