Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKW SLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIV QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGE EEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNE ATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVT NVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
    • Molecular weight
      32 kDa
    • Amino acids
      29 to 315
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Mature protein; constructed with codon optimization and expressed with a small T7-His-TEV cleavage site tag . NP_002329.

Specifications

Our Abpromise guarantee covers the use of ab182797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182797 was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and
    Glycerol.

General Info

  • Alternative names
    • IgLON family member 3
    • IGLON3
    • Lam
    • LAMP
    • Limbic system associated membrane protein
    • Limbic system associated membrane protein precursor
    • Limbic system-associated membrane protein
    • LSAMP
    • LSAMP_HUMAN
    see all
  • Function
    Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.
  • Tissue specificity
    Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. IgLON family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab182797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up