Overview

  • Product name
    Recombinant Human LSM1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNYMPGTASLIEDIDKKHLVLLRDGRTLIG FLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLE KESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTL DEY
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 133
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101157 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Cancer associated Sm like protein
    • Cancer associated Sm-like
    • Cancer-associated Sm-like
    • CASM
    • lsm1
    • LSM1 antibody
    • LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
    • Lsm1 protein
    • LSM1, U6 small nuclear RNA associated
    • LSM1_HUMAN
    • Small nuclear ribonuclear CaSm
    • U6 snRNA associated Sm-like protein LSm1
    • U6 snRNA-associated Sm-like protein LSm1
    • YJL124C
    see all
  • Function
    Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.
  • Tissue specificity
    Has elevated expression in pancreatic cancer and in several cancer-derived cell lines.
  • Sequence similarities
    Belongs to the snRNP Sm proteins family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab101157 at approximately 17.3kDa (3µg).

References

ab101157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up