Overview

  • Product nameRecombinant Human LSM1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15116
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMNYMPGTASLIEDIDKKHLVLLRDGRTLIG FLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLE KESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTL DEY
    • Molecular weight17 kDa including tags
    • Amino acids1 to 133
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101157 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Cancer associated Sm like protein
    • Cancer associated Sm-like
    • Cancer-associated Sm-like
    • CASM
    • lsm1
    • LSM1 antibody
    • LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)
    • Lsm1 protein
    • LSM1, U6 small nuclear RNA associated
    • LSM1_HUMAN
    • Small nuclear ribonuclear CaSm
    • U6 snRNA associated Sm-like protein LSm1
    • U6 snRNA-associated Sm-like protein LSm1
    • YJL124C
    see all
  • FunctionPlays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA.
  • Tissue specificityHas elevated expression in pancreatic cancer and in several cancer-derived cell lines.
  • Sequence similaritiesBelongs to the snRNP Sm proteins family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human LSM1 protein images

  • 15% SDS-PAGE showing ab101157 at approximately 17.3kDa (3µg).

References for Recombinant Human LSM1 protein (ab101157)

ab101157 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"