Overview

  • Product nameRecombinant Human LSM2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y333
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSIC GTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADE VDTQLLQDAARKEALQQKQ
    • Molecular weight13 kDa including tags
    • Amino acids1 to 95
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab124544 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • C6orf28
    • Chromosome 6 open reading frame 28
    • G7b
    • LSM 2
    • Lsm2
    • LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
    • Lsm2 protein
    • LSM2_HUMAN
    • OTTHUMP00000029159
    • Protein G7b
    • Small nuclear ribonuclear protein D homolog
    • snRNP
    • snRNP core Sm like protein Sm x5
    • snRNP core Sm-like protein Sm-x5
    • U6 snRNA associated Sm like protein LSm2
    • U6 snRNA-associated Sm-like protein LSm2
    • YBL026W
    see all
  • FunctionBinds specifically to the 3'-terminal U-tract of U6 snRNA. May be involved in pre-mRNA splicing.
  • Sequence similaritiesBelongs to the snRNP Sm proteins family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human LSM2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124544.

References for Recombinant Human LSM2 protein (ab124544)

ab124544 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"