Overview

  • Product nameRecombinant Human LSM3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP62310
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMADDVDQQQTTNTVEEPLDLIRLSLDE RIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKS TKRNIPMLFVRGDGVVLVAPPLRVG
    • Molecular weight14 kDa including tags
    • Amino acids1 to 102
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • lsm3
    • LSM3 homolog
    • LSM3 protein
    • LSM3_HUMAN
    • MDS017
    • SMX4
    • U6 small nuclear RNA associated (S. cerevisiae)
    • U6 snRNA associated Sm like protein LSm3
    • U6 snRNA-associated Sm-like protein LSm3
    • USS2
    • YLR438C
    see all
  • FunctionBinds specifically to the 3'-terminal U-tract of U6 snRNA.
  • Sequence similaritiesBelongs to the snRNP Sm proteins family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human LSM3 protein images

  • 15% SDS-PAGE analysis of 3 µg of LSM3 (ab124558).

References for Recombinant Human LSM3 protein (ab124558)

ab124558 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"