Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y4Z0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLV SCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEK KPGRQAGKQ
    • Molecular weight18 kDa including tags
    • Amino acids1 to 139
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101871 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glycine rich protein
    • GRP
    • LSM 4
    • LSM4 homolog
    • LSM4 homolog U6 small nuclear RNA associated
    • LSM4 homolog U6 small nuclear RNA associated (S. cerevisiae)
    • U6 small nuclear RNA associated
    • U6 snRNA associated Sm like protein
    • U6 snRNA associated Sm like protein 4
    • U6 snRNA associated Sm like protein LSm 4
    • U6 snRNA associated Sm like protein LSm4
    • YER 112W
    • YER112W
    see all
  • RelevanceSm like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm like proteins are thought to form a stable heteromer present in tri snRNP particles, which are important for pre mRNA splicing.
  • Cellular localizationNuclear

Recombinant Human LSM4 protein images

  • 15% SDS PAGE analysis of 3µg ab101871.

References for Recombinant Human LSM4 protein (ab101871)

ab101871 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"