Overview

  • Product name
    Recombinant Human LSM4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLV SCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEK KPGRQAGKQ
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 139
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101871 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Glycine rich protein
    • GRP
    • LSM 4
    • LSM4 homolog
    • LSM4 homolog U6 small nuclear RNA associated
    • LSM4 homolog U6 small nuclear RNA associated (S. cerevisiae)
    • U6 small nuclear RNA associated
    • U6 snRNA associated Sm like protein
    • U6 snRNA associated Sm like protein 4
    • U6 snRNA associated Sm like protein LSm 4
    • U6 snRNA associated Sm like protein LSm4
    • YER 112W
    • YER112W
    see all
  • Relevance
    Sm like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm like proteins are thought to form a stable heteromer present in tri snRNP particles, which are important for pre mRNA splicing.
  • Cellular localization
    Nuclear

Images

  • 15% SDS PAGE analysis of 3µg ab101871.

References

ab101871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up