Overview

  • Product name
    Recombinant Human LSP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAG DMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      240 to 338

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 47 kDa actin binding protein
    • 47 kDa actin-binding protein
    • 52 kDa phosphoprotein
    • F actin binding and cytoskeleton associated protein
    • Leufactin
    • Leufactin (leukocyte F-actin binding protein)
    • Leukocyte F actin binding protein
    • Leukocyte specific protein 1
    • LSP 1
    • Lsp1
    • LSP1_HUMAN
    • Lymphocyte specific antigen WP34
    • Lymphocyte specific protein 1
    • Lymphocyte specific protein pp52
    • Lymphocyte-specific antigen WP34
    • Lymphocyte-specific protein 1
    • OTTHUMP00000014138
    • OTTHUMP00000014139
    • OTTHUMP00000014140
    • OTTHUMP00000069612
    • OTTHUMP00000069614
    • OTTHUMP00000069615
    • OTTHUMP00000069616
    • pp52
    • Protein pp52
    • S37 protein
    • WP 34
    • WP34
    see all
  • Function
    May play a role in mediating neutrophil activation and chemotaxis.
  • Tissue specificity
    Activated T-lymphocytes.
  • Post-translational
    modifications
    Phosphorylated by casein kinase II, protein kinase C and MAPKAPK2. Phosphorylation by PKC induces translocation from membrane to cytoplasm. Phosphorylation by MAPKAPK2 may regulate neutrophil chemotaxis.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114657 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up