Overview

  • Product name
    Recombinant Human LSP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAG DMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      240 to 338

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 47 kDa actin binding protein
    • 47 kDa actin-binding protein
    • 52 kDa phosphoprotein
    • F actin binding and cytoskeleton associated protein
    • Leufactin
    • Leufactin (leukocyte F-actin binding protein)
    • Leukocyte F actin binding protein
    • Leukocyte specific protein 1
    • LSP 1
    • Lsp1
    • LSP1_HUMAN
    • Lymphocyte specific antigen WP34
    • Lymphocyte specific protein 1
    • Lymphocyte specific protein pp52
    • Lymphocyte-specific antigen WP34
    • Lymphocyte-specific protein 1
    • OTTHUMP00000014138
    • OTTHUMP00000014139
    • OTTHUMP00000014140
    • OTTHUMP00000069612
    • OTTHUMP00000069614
    • OTTHUMP00000069615
    • OTTHUMP00000069616
    • pp52
    • Protein pp52
    • S37 protein
    • WP 34
    • WP34
    see all
  • Function
    May play a role in mediating neutrophil activation and chemotaxis.
  • Tissue specificity
    Activated T-lymphocytes.
  • Post-translational
    modifications
    Phosphorylated by casein kinase II, protein kinase C and MAPKAPK2. Phosphorylation by PKC induces translocation from membrane to cytoplasm. Phosphorylation by MAPKAPK2 may regulate neutrophil chemotaxis.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human LSP1 protein images

  • ab114657 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human LSP1 protein (ab114657)

ab114657 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up