Overview

  • Product name
    Recombinant Human LST1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQ SRNSTMHLCRGCQCPAVRDLTSGAETREAPRRIQELTMPALLRTNPPEHP RHLPQPRRVDRVPLWSSQ
    • Amino acids
      1 to 118
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B144
    • B144 protein
    • D6S49E
    • Leucocyte specific transcript 1
    • Leukocyte-specific transcript 1 protein
    • Liver Specific Transporter
    • LIVTR
    • LST 1
    • Lst1
    • LST1_HUMAN
    • lymphocyte antigen 117
    • MGC119006
    • MGC119007
    • OTTHUMP00000029390
    • OTTHUMP00000029391
    • OTTHUMP00000029392
    • OTTHUMP00000029396
    • OTTHUMP00000029397
    • OTTHUMP00000029398
    • OTTHUMP00000038208
    • OTTHUMP00000038211
    • OTTHUMP00000038213
    • OTTHUMP00000038312
    • OTTHUMP00000038314
    • OTTHUMP00000038315
    • OTTHUMP00000038651
    • OTTHUMP00000038655
    • OTTHUMP00000038657
    • OTTHUMP00000166011
    • OTTHUMP00000166014
    • OTTHUMP00000166016
    • OTTHUMP00000166017
    • OTTHUMP00000166018
    • OTTHUMP00000166019
    • OTTHUMP00000215143
    • Protein B144
    see all
  • Function
    Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
  • Tissue specificity
    Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
  • Sequence similarities
    Belongs to the LST1 family.
  • Cellular localization
    Membrane. Golgi apparatus membrane. Endomembrane system. Also detected in a perinuclear region corresponding to the localization of the Golgi apparatus and throughout the cytoplasm.
  • Information by UniProt

Images

  • ab159916 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up