Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14766-2
    • SpeciesHuman
    • SequenceCPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKE EPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLS
    • Molecular weight36 kDa including tags
    • Amino acids403 to 500

Specifications

Our Abpromise guarantee covers the use of ab114738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9430031G15Rik
    • 9830146M04
    • Latent transforming growth factor beta binding protein 1
    • Latent-transforming growth factor beta-binding protein 1
    • Latent-transforming growth factor beta-binding protein, isoform 1L
    • Latent-transforming growth factor beta-binding protein, isoform 1S
    • LBT1S
    • LTBP-1
    • Ltbp1
    • LTBP1_HUMAN
    • MGC163161
    • TGF-beta1-BP-1
    • Tgfb
    • Transforming growth factor beta-1-binding protein 1
    • Transforming growth factor beta-1-masking protein large subunit
    see all
  • FunctionMay be involved in the assembly, secretion and targeting of TGFB1 to sites at which it is stored and/or activated. May play critical roles in controlling and directing the activity of TGFB1. May have a structural role in the extra cellular matrix (ECM).
  • Tissue specificityIsoform Long is found in fibroblasts.
  • Sequence similaritiesBelongs to the LTBP family.
    Contains 18 EGF-like domains.
    Contains 4 TB (TGF-beta binding) domains.
  • DomainAssociates covalently with small latent TGF-beta complex via domain TB 3.
  • Post-translational
    modifications
    Contains hydroxylated asparagine residues.
    Isoform Short N-terminus is blocked.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human LTBP1 protein images

  • 12.5% SDS-PAGE showing ab114738 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References for Recombinant Human LTBP1 protein (ab114738)

ab114738 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"