Recombinant Human LTBP2 protein (ab158832)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human LTBP2 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCD CFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGY VAEAGPPHCT -
Amino acids
1709 to 1818 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab158832 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- C14orf141
- Chromosome 14 open reading frame 141
- Latent TGF beta binding protein 2
see all -
Function
May play an integral structural role in elastic-fiber architectural organization and/or assembly. -
Tissue specificity
Expressed in lung, weakly expressed in heart, placenta, liver and skeletal muscle. -
Involvement in disease
Defects in LTBP2 are the cause of primary congenital glaucoma type 3D (GLC3D) [MIM:613086]. An autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early childhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor.
Defects in LTBP2 are the cause of microspherophakia (MCSPH) [MIM:251750]. It is a rare disease characterized by smaller and more spherical lenses than normal bilaterally, an increased anteroposterior thickness of the lens and highly myopic eyes. Lens dislocation or subluxation may occur, leading to defective accommodation. -
Sequence similarities
Belongs to the LTBP family.
Contains 20 EGF-like domains.
Contains 4 TB (TGF-beta binding) domains. -
Domain
Associates covalently with small latent TGF-beta complex via Repeat B and Repeat C. -
Post-translational
modificationsContains hydroxylated asparagine residues. -
Cellular localization
Secreted. Localized in nuchal ligament and aorta to the fibrillin-containing, microfibrillar component of elastic fibers. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab158832 has not yet been referenced specifically in any publications.