Overview

  • Product name
    Recombinant Human LTBP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCD CFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGY VAEAGPPHCT
    • Amino acids
      1709 to 1818
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf141
    • Chromosome 14 open reading frame 141
    • Latent TGF beta binding protein 2
    • Latent transforming growth factor beta binding protein 2
    • Latent-transforming growth factor beta-binding protein 2
    • LTBP 2
    • LTBP 3
    • LTBP-2
    • Ltbp2
    • LTBP2_HUMAN
    • LTBP3
    • MSTP 031
    • MSTP031
    see all
  • Function
    May play an integral structural role in elastic-fiber architectural organization and/or assembly.
  • Tissue specificity
    Expressed in lung, weakly expressed in heart, placenta, liver and skeletal muscle.
  • Involvement in disease
    Defects in LTBP2 are the cause of primary congenital glaucoma type 3D (GLC3D) [MIM:613086]. An autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early childhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor.
    Defects in LTBP2 are the cause of microspherophakia (MCSPH) [MIM:251750]. It is a rare disease characterized by smaller and more spherical lenses than normal bilaterally, an increased anteroposterior thickness of the lens and highly myopic eyes. Lens dislocation or subluxation may occur, leading to defective accommodation.
  • Sequence similarities
    Belongs to the LTBP family.
    Contains 20 EGF-like domains.
    Contains 4 TB (TGF-beta binding) domains.
  • Domain
    Associates covalently with small latent TGF-beta complex via Repeat B and Repeat C.
  • Post-translational
    modifications
    Contains hydroxylated asparagine residues.
  • Cellular localization
    Secreted. Localized in nuchal ligament and aorta to the fibrillin-containing, microfibrillar component of elastic fibers.
  • Information by UniProt

Images

  • ab158832 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up