Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVC ATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGM FCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAV LLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEP PKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTRE PQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPA TPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQ FITHD
    • Molecular weight
      70 kDa including tags
    • Amino acids
      31 to 435

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD18
    • D12S370
    • LT beta R
    • LTBETAR
    • Ltbr
    • Lymphotoxin B receptor
    • Lymphotoxin beta receptor
    • Lymphotoxin beta receptor (TNFR superfamily, member 3)
    • Lymphotoxin-beta receptor
    • TNF R III
    • TNF-RIII
    • TNFCR
    • TNFR RP
    • TNFR superfamily member 3
    • TNFR-III
    • TNFR2 RP
    • TNFR2RP
    • TNFR3
    • TNFRII
    • TNFRRP
    • TNFRSF 3
    • TNFRSF3
    • TNR3_HUMAN
    • Tumor necrosis factor C receptor
    • Tumor necrosis factor receptor 2 related protein
    • Tumor necrosis factor receptor 2-related protein
    • Tumor necrosis factor receptor superfamily member 3
    • Tumor necrosis factor receptor superfamily member 3 precursor
    • Tumor necrosis factor receptor type III
    see all
  • Function
    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
  • Sequence similarities
    Contains 4 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152507 stained with Coomassie Blue.

References

ab152507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up