Recombinant Human Lubricin protein (ab153060)

Overview

  • Product name
    Recombinant Human Lubricin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAI SLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
    • Amino acids
      1305 to 1404
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Articular superficial zone protein
    • bG174L6.2
    • CACP
    • Camptodactyly arthropathy coxa vara pericarditis syndrome gene
    • FLJ32635
    • HAPO
    • Jacobs camptodactyly arthropathy pericarditis syndrome gene
    • JCAP
    • Megakaryocyte stimulating factor
    • MSF
    • PRG 4
    • PRG4
    • Proteoglycan 4
    • Proteoglycan4
    • Superficial zone proteoglycan
    • SZP
    see all
  • Relevance
    Lubricin is a glycoprotein encoded by the PRG4 gene. It has been identified as a component of joint lubrication and synovial homeostasis by reducing friction in joints and preventing synovial cell overgrowth. It is a large, water soluble molecule that acts as a carrier for insoluble surface-active phospholipid (SAPL). Depletion of lubricin function has been associated with camptodactyly-arthropathy-coxa vara-pericarditis syndrome (CACP), an arthritic-like autosomal recessive disorder.
  • Cellular localization
    Secreted

Images

  • ab153060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up