Recombinant Human Lumican protein (ab114635)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51884
    • SpeciesHuman
    • SequenceMSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSA MYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHN LLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKIT KLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNS FNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
    • Molecular weight63 kDa including tags
    • Amino acids1 to 338

Specifications

Our Abpromise guarantee covers the use of ab114635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Keratan sulfate proteoglycan lumican
    • KSPG lumican
    • LDC
    • LUM
    • LUM_HUMAN
    • Lumican
    • Lumican precursor
    • SLRR2D
    see all
  • Tissue specificityCornea and other tissues.
  • Sequence similaritiesBelongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Developmental stagePresent in the extracellular matrix of human articular cartilage at all ages, although its abundance is far greater in the adult. In the adult cartilage lumican exists predominantly in a glycoprotein form lacking keratan sulfate, whereas the juvenile form of the molecule is a proteoglycan.
  • Post-translational
    modifications
    Sulfated on tyrosine residue(s).
  • Cellular localizationSecreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human Lumican protein images

  • ab114635 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Lumican protein (ab114635)

ab114635 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"