Recombinant Human Lumican protein (ab114635)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSA MYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHN LLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKIT KLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLP SGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNS FNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 338

Specifications

Our Abpromise guarantee covers the use of ab114635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Keratan sulfate proteoglycan lumican
    • KSPG lumican
    • LDC
    • LUM
    • LUM_HUMAN
    • Lumican
    • Lumican precursor
    • SLRR2D
    see all
  • Tissue specificity
    Cornea and other tissues.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Developmental stage
    Present in the extracellular matrix of human articular cartilage at all ages, although its abundance is far greater in the adult. In the adult cartilage lumican exists predominantly in a glycoprotein form lacking keratan sulfate, whereas the juvenile form of the molecule is a proteoglycan.
  • Post-translational
    modifications
    Sulfated on tyrosine residue(s).
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab114635 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up