Recombinant Human Lumican protein (ab151646)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGI KYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQL KKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQH NRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKIS NIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKN IPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISE TSLPPDMYECLRVANEVTLNVDHHHHHH
    • Molecular weight
      37 kDa
    • Amino acids
      19 to 338
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151646 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes

    ab151646 was produced by transfected Human cells.

    The apparent molecular mass of the protein is approximately 60kDa in SDS-PAGE under reducing conditions due to glycosylation.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.03% EDTA, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names
    • Keratan sulfate proteoglycan lumican
    • KSPG lumican
    • LDC
    • LUM
    • LUM_HUMAN
    • Lumican
    • Lumican precursor
    • SLRR2D
    see all
  • Tissue specificity
    Cornea and other tissues.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 11 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Developmental stage
    Present in the extracellular matrix of human articular cartilage at all ages, although its abundance is far greater in the adult. In the adult cartilage lumican exists predominantly in a glycoprotein form lacking keratan sulfate, whereas the juvenile form of the molecule is a proteoglycan.
  • Post-translational
    modifications
    Sulfated on tyrosine residue(s).
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab151646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up