Recombinant Human Lunatic Fringe protein (ab116899)

Overview

  • Product nameRecombinant Human Lunatic Fringe protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ8NES3
    • SpeciesHuman
    • SequenceMTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSC KMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPS LDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFM NTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCPRTAIF
    • Molecular weight53 kDa including tags
    • Amino acids1 to 250

Specifications

Our Abpromise guarantee covers the use of ab116899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-N-acetylglucosaminyltransferase lunatic fringe
    • Beta-1
    • Beta-13-N-acetylglucosaminyltransferase lunatic fringe
    • lfng
    • LFNG_HUMAN
    • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
    • SCDO3
    see all
  • FunctionGlycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Decreases the binding of JAGGED1 to NOTCH2 but not that of DELTA1. Essential mediator of somite segmentation and patterning.
  • Involvement in diseaseDefects in LFNG are the cause of spondylocostal dysostosis type 3 (SCDO3) [MIM:609813]. An autosomal recessive condition of variable severity associated with vertebral and rib segmentation defects. The main skeletal malformations include fusion of vertebrae, hemivertebrae, fusion of certain ribs, and other rib malformations. Deformity of the chest and spine (severe scoliosis, kyphoscoliosis and lordosis) is a natural consequence of the malformation and leads to a dwarf-like appearance. As the thorax is small, infants frequently have respiratory insufficiency and repeated respiratory infections resulting in life-threatening complications in the first year of life.
  • Sequence similaritiesBelongs to the glycosyltransferase 31 family.
  • Post-translational
    modifications
    A soluble form may be derived from the membrane form by proteolytic processing.
  • Cellular localizationGolgi apparatus membrane.
  • Information by UniProt

Recombinant Human Lunatic Fringe protein images

  • 12.5% SDS-PAGE showing ab116899 at approximately 53.24 kDa stained with Coomassie Blue.

References for Recombinant Human Lunatic Fringe protein (ab116899)

ab116899 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"