Recombinant Human Lymphocyte Antigen 6 Complex protein (ab162829)

Overview

  • Product name
    Recombinant Human Lymphocyte Antigen 6 Complex protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRAD PPWAPLGTMALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVW CHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAM ERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGE SCGGLWLAILLLLASIAAGLSLS
    • Amino acids
      1 to 223
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lymphocyte antigen Ly-6K
    • 2410015A16Rik
    • 3110035B01Rik
    • CT97
    • FLJ35226
    • HSJ001348
    • ly 6K
    • Lymphocyte antigen 6 complex, locus K
    • mLy 6K
    • ThB
    • Thymocyte B cell antigen
    see all
  • Relevance
    The Lymphocyte Antigen 6 Complex is a 15 kDa phosphatidyl inositol anchored molecule, attached to the cell membrane by a GPI-anchor. The Lymphocyte Antigen 6 Complex is present on most immature T cells of the thymus, on lymphoid cells in bone marrow and peripheral B cells, but absent on peripheral T cells.
  • Cellular localization
    Cell Membrane

Images

  • ab162829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
This recombination protein is great in using as a positive control for western blot. I tried two primary antibodies from two different companies (please see my image for details), they both worked super. The band is very clean and at the correct molecular weight (it has a GST tag).
Username

Abcam user community

Verified customer

Submitted Jun 27 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up