Recombinant Human Lymphotactin protein (Fc Chimera His Tag) (ab191990)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCAD PQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGR MDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Molecular weight
      38 kDa
    • Amino acids
      22 to 114
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 22 to 114. The signal peptide is not included. Fused with a polyhistidine tag and FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • ATAC
    • C motif chemokine 1
    • Chemokine (C motif) ligand 1
    • Chemokine C Motif Ligand 1
    • Cytokine SCM-1
    • LPTN
    • LTN
    • Lymphotactin
    • Lymphotaxin
    • SCM 1
    • SCM 1 alpha
    • SCM 1a
    • SCM-1-alpha
    • SCM1
    • SCM1A
    • SCYC1
    • Single cysteine motif 1a
    • Small inducible cytokine C1
    • Small Inducible Cytokine Subfamily C Member 1
    • Small inducible cytokine subfamily C, member 1 (lymphotactin)
    • Small-inducible cytokine C1
    • X-C motif chemokine ligand 1
    • XC chemokine ligand 1
    • Xcl1
    • XCL1_HUMAN
    see all
  • Function
    Chemotactic activity for lymphocytes but not for monocytes or neutrophils.
  • Tissue specificity
    Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
  • Sequence similarities
    Belongs to the intercrine gamma family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab191990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up