Recombinant Human LYPLA2 protein (ab105129)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCGNTMSVPLLTDAATVSGAERETAAVIFL HGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMG LSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 231
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105129 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Acyl protein thioesterase
    • Acyl protein thioesterase 2
    • Acyl-protein thioesterase 2
    • APT 2
    • APT-2
    • APT2
    • DJ886K2.4
    • EC 3.1.2.-
    • LPL I
    • LPL II
    • LPL-II
    • LYPA2_HUMAN
    • LYPLA 2
    • Lypla2
    • Lysophospholipase II
    • LysoPLA II
    • OTTHUMP00000002999
    • OTTHUMP00000044831
    see all
  • Function
    May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has lysophospholipase activity (By similarity). Deacylates GAP43.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. AB hydrolase 2 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human LYPLA2 protein images

  • 15% SDS-PAGE showing ab105129 at approximately 26.9kDa (3µg).

References for Recombinant Human LYPLA2 protein (ab105129)

ab105129 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up