Recombinant Human LYPLA2 protein (ab105129)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95372
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCGNTMSVPLLTDAATVSGAERETAAVIFL HGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMG LSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V
    • Molecular weight27 kDa including tags
    • Amino acids1 to 231
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105129 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Acyl protein thioesterase
    • Acyl protein thioesterase 2
    • Acyl-protein thioesterase 2
    • APT 2
    • APT-2
    • APT2
    • DJ886K2.4
    • EC 3.1.2.-
    • LPL I
    • LPL II
    • LPL-II
    • LYPA2_HUMAN
    • LYPLA 2
    • Lypla2
    • Lysophospholipase II
    • LysoPLA II
    • OTTHUMP00000002999
    • OTTHUMP00000044831
    see all
  • FunctionMay hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has lysophospholipase activity (By similarity). Deacylates GAP43.
  • Sequence similaritiesBelongs to the AB hydrolase superfamily. AB hydrolase 2 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human LYPLA2 protein images

  • 15% SDS-PAGE showing ab105129 at approximately 26.9kDa (3µg).

References for Recombinant Human LYPLA2 protein (ab105129)

ab105129 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"