Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGW VILVGTGALGLLLLFLLGYGWAAACAGSRKKRRSPPRKREEAAAVPAAAP DDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAK QPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHRE KRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGD SHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAG EEKWNSVSPASAGKRKAEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEE WGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKK KQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSLKTISTSDPAE VLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNT KQNSVPPSQTKSETSWESPKQIKKKKKARRET
    • Amino acids
      1 to 582
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3D3
    • 3D3/LYRIC
    • AEG 1
    • AEG-1
    • AEG1
    • Astrocyte elevated gene 1
    • Astrocyte elevated gene-1 protein
    • LYRIC
    • LYRIC/3D3
    • LYRIC_HUMAN
    • Lysine rich CEACAM1 associated protein
    • Lysine rich CEACAM1 co isolated protein
    • Lysine-rich CEACAM1 co-isolated protein
    • Metadherin
    • Metastasis adhesion protein
    • MTDH
    • Protein LYRIC
    see all
  • Function
    Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.
  • Tissue specificity
    Widely expressed with highest levels in muscle-dominating organs such as skeletal muscle, heart, tongue and small intestine and in endocrine glands such as thyroid and adrenal gland. Overexpressed in various cancers including breast, brain, prostate, melanoma and glioblastoma multiforme.
  • Cellular localization
    Endoplasmic reticulum membrane. Nucleus membrane. Cell junction > tight junction. Nucleus > nucleolus. Cytoplasm > perinuclear region. In epithelial cells, recruited to tight junctions (TJ) during the maturation of the TJ complexes. A nucleolar staining may be due to nuclear targeting of an isoform lacking the transmembrane domain (By similarity). TNF-alpha causes translocation from the cytoplasm to the nucleus.
  • Information by UniProt

Images

  • ab153570 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up