Recombinant Human Lysophospholipase 1 protein (ab151829)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF KTYEGMMHSSCQQEMMDVKQFIDKLLPPID
    • Molecular weight
      25 kDa
    • Amino acids
      1 to 230
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151829 is greater than 95% pure, as determined by SEC-HPLC.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Acyl protein thioesterase 1
    • Acyl-protein thioesterase 1
    • APT 1
    • APT-1
    • APT1
    • hAPT1
    • LPL-I
    • LPL1
    • LYPA1_HUMAN
    • LYPLA 1
    • LYPLA1
    • Lysophospholipase 1
    • Lysophospholipase I
    • Lysophospholipid specific lysophospholipase
    • LYSOPLA
    • LysoPLA I
    see all
  • Function
    Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity and also low lysophospholipase activity.
  • Sequence similarities
    Belongs to the AB hydrolase 2 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab151829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up