Overview

  • Product name
    Recombinant Human LYST protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSTDSNSLAREFLTDVNRLCNAVVQRVEAREEEEEETHMATLGQYLVHGR GFLLLTKLNSIIDQALTCREELLTLLLSLLPLVWKIPVQEEKATDFNLPL
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beige homolog
    • beige protein
    • Chediak-Higashi syndrome 1
    • CHS
    • CHS1
    • Lysosomal-trafficking regulator
    • LYST
    • LYST_HUMAN
    • OTTHUMP00000038327
    see all
  • Function
    May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.
  • Tissue specificity
    Abundantly expressed in adult and fetal thymus, peripheral blood leukocytes, bone marrow and several regions of the adult brain.
  • Involvement in disease
    Defects in LYST are the cause of Chediak-Higashi syndrome (CHS) [MIM:214500]. CHS is a rare autosomal recessive disorder characterized by hypopigmentation, severe immunologic deficiency, a bleeding tendency, neurologic abnormalities, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types. Most patients die at an early age unless they receive an allogeneic hematopoietic stem cell transplant (SCT).
  • Sequence similarities
    Contains 1 BEACH domain.
    Contains 7 WD repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158114 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up