Recombinant Human Lysyl tRNA synthetase protein (ab113142)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15046
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSGVGPEEESVDPNQYYKIRSQAIHQLKV NGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASG GKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPG KTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDF VRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNE LDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCE FYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTP PFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRT TARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELF VMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEY GLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLE STTVGTSV
    • Molecular weight64 kDa including tags
    • Amino acids63 to 597
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab113142 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • CMTRIB
    • DFNB89
    • EC 6.1.1.6
    • KARS
    • KARS 1
    • KARS 2
    • KARS1
    • KARS2
    • KIAA0070
    • KRS
    • Lysine tRNA ligase
    • Lysine--tRNA ligase
    • LysRS
    • Lysyl-tRNA synthetase
    • SYK_HUMAN
    see all
  • FunctionCatalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages. Catalyzes the synthesis of diadenosine oligophosphate (Ap4A), a signaling molecule involved in the activation of MITF transcriptional activity. Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation.
  • Involvement in diseaseDefects in KARS are the cause of Charcot-Marie-Tooth disease recessive intermediate type B (CMTRIB) [MIM:613641]; also called Charcot-Marie-Tooth neuropathy recessive intermediate B. CMTRIB is a form of Charcot-Marie-Tooth disease, a disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. Recessive intermediate forms of Charcot-Marie-Tooth disease are characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
  • Sequence similaritiesBelongs to the class-II aminoacyl-tRNA synthetase family.
  • DomainThe N-terminal domain (1-65) of the cytoplasmic isoform is a functional tRNA-binding domain (By similarity), is required for nuclear localization, is involved in the interaction with DARS, but has a repulsive role in the binding to EEF1A1. A central domain (208-259) is involved in homodimerization and is required for interaction with HIV-1 GAG and incorporation into virions. The C-terminal domain (452-597) is not required for interaction with AIMP2.
  • Cellular localizationMitochondrion and Cytoplasm. Nucleus. Cell membrane. Secreted. Secretion is induced by TNF-alpha.
  • Information by UniProt

Recombinant Human Lysyl tRNA synthetase protein images

  • 15% SDS-PAGE analysis of ab113142 (3µg)

References for Recombinant Human Lysyl tRNA synthetase protein (ab113142)

ab113142 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"