Recombinant Human LZTFL1 protein (ab162797)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLR VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
    • Amino acids
      200 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5530402H04Rik
    • 6130400H19Rik
    • AI414725
    • AW048545
    • BBS17
    • DKFZp686H2076
    • FLJ36386
    • Leucine zipper transcription factor like 1
    • Leucine zipper transcription factor like protein 1
    • Leucine zipper transcription factor-like protein 1
    • LZTFL 1
    • Lztfl1
    • Lztfl1 leucine zipper transcription factor-like 1
    • LZTL1_HUMAN
    • MGC106871
    • MGC108960
    • Putative uncharacterized protein DKFZp686H2076
    see all
  • Information by UniProt

Images

  • ab162797 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up