Recombinant Human M6PR (cation dependent) protein (BSA and azide free) (ab180308)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSTEEKTCDLVGEKGKESEKELALVKRLK PLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVV GRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADN FNPVSEERGKVQDCFYLFEMDSSLACSPEISH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      27 to 185
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_002346

Specifications

Our Abpromise guarantee covers the use of ab180308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab180308 was purified by using conventional chromatography techniques..
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 46 kDa mannose 6 phosphate receptor
    • 46 kDa mannose 6-phosphate receptor
    • Cation dependent mannose 6 phosphate receptor
    • Cation dependent mannose 6 phosphate receptor precursor
    • Cation-dependent mannose-6-phosphate receptor
    • CD Man 6 P receptor
    • CD Man-6-P receptor
    • CD MPR
    • CD-M6PR
    • CD-MPR
    • FLJ32994
    • M6pr
    • M6PR protein
    • Man6PR
    • Mannose 6 phosphate receptor
    • Mannose 6 phosphate receptor (cation dependent)
    • MPR 46
    • MPR46
    • MPRD
    • MPRD_HUMAN
    • Mr 46,000 Man6PR
    • Small mannose 6 phosphate receptor
    • SMPR
    see all
  • Function
    Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex.
  • Domain
    The extracellular domain is homologous to the repeating units (of approximately 147 AA) of the cation-independent mannose 6-phosphate receptor.
  • Cellular localization
    Lysosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180308 (3 µg).

References

ab180308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up