Recombinant Human M6PR (cation independent) protein (ab92245)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENC PPGVGACFGQ TRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK SVISFVCRPEAGPTNRPMLISL DKQTCTLFFSWHTPLACEQATECSVR NGSSIVDLSPLIHRTGGYEAYDESEDDASDTNPD FYINICQPLNPMHG VPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEIYLNFESSTP CL ADKHFNYTSL
    • Amino acids
      1510 to 1761

Specifications

Our Abpromise guarantee covers the use of ab92245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 81 µl aqua dest.

General Info

  • Alternative names
    • 300 kDa mannose 6 phosphate receptor
    • 300 kDa mannose 6-phosphate receptor
    • Cation independent mannose 6 phosphate receptor
    • Cation-independent mannose-6-phosphate receptor
    • CD222
    • CD222 antigen
    • CI Man 6 P receptor
    • CI Man-6-P receptor
    • CI MPR
    • CI-M6PR
    • CI-MPR
    • CIMPR
    • IGF 2 receptor
    • IGF 2R
    • IGF II receptor
    • IGF-II receptor
    • IGF2 receptor
    • Igf2r
    • Insulin like growth factor 2 receptor
    • Insulin like growth factor II receptor
    • Insulin-like growth factor 2 receptor
    • Insulin-like growth factor II receptor
    • M6P R
    • M6P/IGF2 receptor
    • M6P/IGF2R
    • M6PR
    • mannose 6 phosphate receptor
    • mannose 6 phosphate receptor, cation independent
    • MPR 300
    • MPR300
    • MPRI
    • MPRI_HUMAN
    see all
  • Function
    Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation, by binding DPP4.
  • Sequence similarities
    Belongs to the MRL1/IGF2R family.
    Contains 1 fibronectin type-II domain.
  • Domain
    Contains 15 repeating units of approximately 147 AA harboring four disulfide bonds each. The most highly conserved region within the repeat consists of a stretch of 13 AA that contains cysteines at both ends.
  • Cellular localization
    Lysosome membrane. Colocalized with DPP4 in internalized cytoplasmic vesicles adjacent to the cell surface.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up