Recombinant Human macroH2A.1 protein (ab160546)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA AVLEYLTAEILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTI ASGGVLPNIHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAG GKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLI HSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRK KNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVY FVLFDSESIGIYVQEMAKLDAN
    • Amino acids
      1 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Core histone macro h2a.1
    • Core histone macro-H2A.1
    • H2A histone family member Y
    • H2A.y
    • H2A/y
    • H2AF12M
    • H2AFJ
    • H2afy
    • H2AY_HUMAN
    • Histone H2A.Y
    • Histone macroH2A1
    • Histone macroH2A1.1
    • Histone macroH2A1.2
    • Macroh2a1
    • MACROH2A1.1
    • MacroH2A1.2
    • Medulloblastoma antigen MU MB 50.205
    • Medulloblastoma antigen MU-MB-50.205
    • mH2a
    • mH2A1
    see all
  • Function
    Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Involved in stable X chromosome inactivation. Inhibits the binding of transcription factors and interferes with the activity of remodeling SWI/SNF complexes. Inhibits histone acetylation by EP300 and recruits class I HDACs, which induces an hypoacetylated state of chromatin. In addition, isoform 1, but not isoform 2, binds ADP-ribose and O-acetyl-ADP-ribose, and may be involved in ADP-ribose-mediated chromatin modulation.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 histone H2A domain.
    Contains 1 Macro domain.
  • Post-translational
    modifications
    Monoubiquitinated at either Lys-116 or Lys-117. May also be polyubiquitinated. Ubiquitination is mediated by the CUL3/SPOP E3 complex and does not promote proteasomal degradation. Instead, it is required for enrichment in inactive X chromosome chromatin.
  • Cellular localization
    Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin.
  • Information by UniProt

Images

  • ab160546 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up