Recombinant Human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab106871)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFE TSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
    • Molecular weight
      10 kDa including tags
    • Amino acids
      24 to 92
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab106871 is purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5

General Info

  • Alternative names
    • C C motif chemokine 3
    • CCL 3
    • CCL3
    • CCL3_HUMAN
    • Chemokine C C motif ligand 3
    • G0/G1 switch regulatory protein 19 1
    • G0/G1 switch regulatory protein 19-1
    • G0S19 1
    • G0S19 1 protein
    • Heparin binding chemotaxis protein
    • L2G25B
    • LD78 alpha
    • LD78-alpha(4-69)
    • LD78alpha
    • Macrophage inflammatory protein 1 alpha
    • Macrophage inflammatory protein 1-alpha
    • MIP 1 alpha
    • MIP 1A
    • MIP-1-alpha
    • MIP-1-alpha(4-69)
    • MIP1A
    • PAT 464.1
    • SCYA 3
    • SCYA3
    • SIS alpha
    • SIS beta
    • SIS-beta
    • Small inducible cytokine A3
    • small inducible cytokine A3 (homologous to mouse Mip-1a)
    • Small-inducible cytokine A3
    • Tonsillar lymphocyte LD78 alpha protein
    see all
  • Function
    Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Macrophage Inflammatory Protein 1 alpha / CCL3 images

  • 15% SDS-PAGE analysis of 3µg ab106871.

    Note: Molecular weight on SDS-PAGE will appear higher.

References for Recombinant Human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab106871)

ab106871 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up